PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599149.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 912aa    MW: 101286 Da    PI: 5.3574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599149.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-173278148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_013599149.1 32 KGQWTAEEDEVLCKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 78
                     799****************************9.************986 PP

2Myb_DNA-binding612.5e-1984130148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ ++ +v+++G++ W+tI+++++ gR +kqc++rw+++l
   XP_013599149.1  84 KGPWSKEEDDTIIALVEKYGPKKWSTISQHLP-GRIGKQCRERWHNHL 130
                      79******************************.*************97 PP

3Myb_DNA-binding47.25.2e-15136178145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++ +G++ W+   + ++ gR+++++k++w+
   XP_013599149.1 136 KNAWTQEEEVTLIRAHQIYGNK-WAELTKFLP-GRSDNSIKNHWN 178
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0672778IPR017930Myb domain
SMARTSM007172.7E-143180IPR001005SANT/Myb domain
PfamPF002492.0E-143278IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-213390IPR009057Homeodomain-like
SuperFamilySSF466891.72E-153388IPR009057Homeodomain-like
CDDcd001672.84E-133578No hitNo description
PROSITE profilePS5129432.54179134IPR017930Myb domain
SuperFamilySSF466894.87E-3181177IPR009057Homeodomain-like
SMARTSM007172.2E-1883132IPR001005SANT/Myb domain
PfamPF002495.4E-1884130IPR001005SANT/Myb domain
CDDcd001674.72E-1686130No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2791137IPR009057Homeodomain-like
PROSITE profilePS5129418.066135185IPR017930Myb domain
SMARTSM007172.0E-14135183IPR001005SANT/Myb domain
PfamPF002491.4E-13136179IPR001005SANT/Myb domain
CDDcd001675.27E-11138178No hitNo description
Gene3DG3DSA:1.10.10.601.7E-21138185IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 912 aa     Download sequence    Send to blast
MKSEMKAPTI PQAGSKKGSH GRPCGPARRS TKGQWTAEED EVLCKAVERF QGKNWKKIAE  60
CFKDRTDVQC LHRWQKVLNP ELVKGPWSKE EDDTIIALVE KYGPKKWSTI SQHLPGRIGK  120
QCRERWHNHL NPGINKNAWT QEEEVTLIRA HQIYGNKWAE LTKFLPGRSD NSIKNHWNSS  180
VKKKLDSYYA SGLLDQSQSS PLIPIQNNSI ASSSSWMHSS GDEGNFRPGA DAEESECSQA  240
STVFSCSQST NDLLDEVKPA KEEFYIPELP SGTEQQISNS PSHAESYYPS FEDVKIVLPE  300
ISYEAESSKE YQNHNGLTEV RTITATEDHL QAVCNNDKQD RDLDCPQLLG DEKNEACQAF  360
QNSVRLTDQP SMPNSDTCMH PQPQTLITDE ECCRVLFTST TEDSGVASGE QGPNLVDTQN  420
GKGSIPASET ENLPALSWHP SNSNDSIQDC HLLEATALEH KVDTKDGFID NSGHVTSHGN  480
DDNDGIPDQQ EPSYIPKDSL KLVPLNNFTS PSRVNKINFP VNDKPAEKDK GSLCYEPPRF  540
PSADIPFFSC DLVPSNCDLR QEYSPFGIRQ LMMSCTTPLR LWDSPCHNKS PDVILKDAAK  600
SFSGTPSILK KRQHRDLMSP VLDRRKEKML KSAEASSLAK DFSRLDVMLN GCSSSILSER  660
PDNRNEHASS SEAKKDPKET LESGGVTSAK IDQETRRSLV YCNDVEMQLS SPDKSGSRPD  720
NKVNTTASEP PFTVDSIPLS AIAGNKTNNA ESSFDIIENC SIFDGTPFKQ LLDTPSPWKS  780
PLLFGSFLQS PRLPPEITFE DIGCFMSPGD RSYDAIGLMK HLSEHTATAY ADALEVLGND  840
TPETILKKRQ LNKSIQGKEN QHWPHDQLEN RSQVECRALD FSDCGTPGKA KVSSASPGGY  900
MSPSSYLLKS CR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-67321856159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-67321856159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599149.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013599148.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013599147.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D3DHD30.0A0A0D3DHD3_BRAOL; Uncharacterized protein
STRINGBra037045.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein